GRK3/ADRBK2 Antibody orb316545 from Biorbyt

Product Specs
ItemGRK3/ADRBK2 Antibody
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb316545
Quantity10 µg, 100 µg
ApplicationsFC, ICC, IF, WB
Conjugate/TagUnconjugated
FormatLyophilized
ReactivityHuman
TargetGRK3/ADRBK2
IsotypeRabbit IgG
HostRabbit
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human GRK3 (635-669aa ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR), different from the related mouse and rat sequences by five amino acids
NCBI Full Gene NameG protein-coupled receptor kinase 3
NCBI Gene AliasesADRBK2, BARK2
ClonalityPolyclonal
Molecular Weight79710 MW
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles

Specifications/Features

Application Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Application Dilutions: Western blot, 0.1-0.5µg/ml, Human Immunocytochemistry/Immunofluorescence, 2µg/ml, Human Flow Cytometry, 1-3µg/1x106 cells, Human

Add to Compare List